SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|337288946|ref|YP_004628418.1| from Thermodesulfobacterium sp. OPB45

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|337288946|ref|YP_004628418.1|
Domain Number 1 Region: 4-251
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 3.61e-67
Family FdhD/NarQ 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|337288946|ref|YP_004628418.1|
Sequence length 253
Comment Protein fdhD [Thermodesulfobacterium geofontis OPF15]
Sequence
MDPVISRKIIKVKENIIQSLEDSIAIETKIKILVNDIEIISLSATPLHIKELVVGYILTE
NIIKENFCPQEIEIIEEKEEIKVKIYSAGPLNLNGKTLTSGCMSSFSFINELPESYKDNF
KIEIENLFLLFKDFQKKSELYKSTGCVHYAGLAEKEKIIFLAEDIGRHNAVDKVIGYAFL
NKIPLEDKILLISGRISSEMVLKTGRWKIPIIVSKSAPTSLAIELAEKIGLTIIGFLRGN
RCNIYTHPYRLNL
Download sequence
Identical sequences F8C2Z9
gi|337288946|ref|YP_004628418.1| WP_013910188.1.95401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]