SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cucsa.066940.1|PACid:16955257 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.066940.1|PACid:16955257
Domain Number 1 Region: 106-223
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 1.44e-17
Family N-utilization substance G protein NusG, N-terminal domain 0.0021
Further Details:      
 
Domain Number 2 Region: 271-321
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00000000542
Family N-utilization substance G protein NusG, C-terminal domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cucsa.066940.1|PACid:16955257
Sequence length 326
Sequence
MACGLLVWSSVSLCSTSFPALSFSLSSSRRTQLSVSASVETPAAAADDAQQLSVRERRKL
RNERREIKTTTNWREEVEERLCRKPKKEFANWTEKLNLDYLAKLGPQWWVMRVARVRSQE
IVERLARSLARNYPDLDFKIYYPSVKEKRKLKNGTYTVTPKAVFPGSVFIRCVMNKEIHD
FIRECDGVGGFVGAKVGNTKRQINKPKPVSEADMEAIFKEAKDEQERHDQAFLEKEQEEA
PNTSALKTDLDTNGTTATKHKGRPKKAVNTLSPGSTVRVASGTFAEFEGSLKKLNRKSGK
VTVGFTLFGKETLVDLDIGDIIVETK
Download sequence
Identical sequences Cucsa.066940.1|PACid:16955257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]