SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cucsa.076230.1|PACid:16955832 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.076230.1|PACid:16955832
Domain Number 1 Region: 90-305,426-473
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.11e-72
Family Tandem AAA-ATPase domain 0.000000501
Further Details:      
 
Domain Number 2 Region: 769-985
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 4.19e-58
Family Helical scaffold and wing domains of SecA 0.0000357
Further Details:      
 
Domain Number 3 Region: 475-583,669-763
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.66e-49
Family Tandem AAA-ATPase domain 0.00000981
Further Details:      
 
Domain Number 4 Region: 304-426
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 3.92e-44
Family Pre-protein crosslinking domain of SecA 0.0000279
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Cucsa.076230.1|PACid:16955832
Sequence length 1031
Sequence
MTTPLCDSPMVNHYHPSLSSQSHKLLLSFESFSLQPHLRSAFIHISPFQFRPRTSKLVHS
TKRNAGPVASLGGFLGGIFRGTDTGESTRQQYASTVAVINGFEAQMSALSDSQLRDKTSM
LKERAQSGEPLDSILPEAFAVVREASKRVLGLRPFDVQLIGGMVLHKGEIAEMRTGEGKT
LVAILPAYLNALTGKGVHVVTVNDYLARRDCEWVGQVPRFLGLKVGLIQQNMTSEERREN
YLSDITYVTNSELGFDYLRDNLATEITFYLSVEELVLRDFSYCVIDEVDSILIDEARTPL
IISGPAEKPSDRYYKAAKLASAFERDIHYTVDEKQKTVLLTEQGYEDAEEILNVKDLYDP
REQWASYVLNAIKAKELFLRDVNYIIRGKEVLIVDEFTGRVMQGRRWSDGLHQAVEAKEG
LPIQNETVTLASISYQNFFLQFPKLCGMTGTAATESTEFESIYKLKVTIVPTNKPMVRKD
ESDVVFRATAGKWRAVVVEISRMHKTGRPVLVGTTSVEQSDALSAQLQEAGIPHEVLNAK
PENVEREAEIVAQSGRLGAVTIATNMAGRGTDIILGGNAEFMARLKLRELLMPRLVKLTN
GAFVSVKKPPPKKTWKVNESLFPCDLSSENAKLAEEAVQFAVKTWGQKSLTELEAEERLS
YSCEKGPAQDDVIAKLRNAFLEIVKEYKVFTEEERKKVVLAGGLHVVGTERHESRRIDNQ
LRGRSGRQGDPGSSRFFLSLEDNIFRIFGGDRIQGLMRAFRVEDLPIESQMLTKALDEAQ
RKVENYFFDIRKQLFEYDEVLNSQRDRVYTERRRALESDSLQALIIEYAELTMDDILEAN
IGSDTPTESWDLEKLIAKVQQYCYLLDDLTPDLIRSKYPTYESLQNYLRLRGREAYLQKR
DIVEKEAPGLMKEAERFLILSNIDRLWKEHLQAIKFVQQAVGLRGYAQRDPLIEYKLEGY
NLFLDMMAQIRRNVIYSIYQFKPVLVKKDQDGGRKEKSGEVVTNGRGTNNNNSGPVAAES
SSSATNPKTTA
Download sequence
Identical sequences Cucsa.076230.1|PACid:16955832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]