SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cucsa.107060.1|PACid:16959552 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.107060.1|PACid:16959552
Domain Number 1 Region: 72-296,417-464
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.74e-72
Family Tandem AAA-ATPase domain 0.000000399
Further Details:      
 
Domain Number 2 Region: 466-574,668-753
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.33e-41
Family Tandem AAA-ATPase domain 0.0000308
Further Details:      
 
Domain Number 3 Region: 295-416
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 1.44e-36
Family Pre-protein crosslinking domain of SecA 0.0000769
Further Details:      
 
Domain Number 4 Region: 776-902,972-1045
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 2.01e-36
Family Helical scaffold and wing domains of SecA 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Cucsa.107060.1|PACid:16959552
Sequence length 1057
Sequence
MATTRAFPKPPSLLPSLQPTIGFVSPISFQTSSSLRYRLRRHRSIVNSSSVATATPVAAS
LKESFGTVRKTWSDLTSMNYWVVRDYYRLVDSVNDFEPQMQSLTDEQLTAKTSEFRRRLR
QGETLADIQSEAFAVVREAAKRKLGMRHFDVQIIGGAVLHDGSIAEMKTGEGKTLVSTLA
AYLNALPGEGVHVVTVNDYLAQRDAEWMGRVHRFLGLSVGLIQRGMTAKERRSNYRCDIT
YTNNSELGFDYLRDNLAGNDGQLVMRWPKPFHFAIVDEVDSVLIDEGRNPLLISGEASKD
AGRYPVAAKVAELLVKGVHYNVELKDNSVELTEEGIAMAEIALETNDLWDENDPWARFVM
NALKAKEFYRRDVQYIVRNGKALIINELTGRVEEKRRWSEGIHQAVEAKEGLKIQADSVI
VAQITYQSLFKLYPKLSGMTGTAKTEEKEFLKMFQTPVIEVPTNLPNIRKDLPIQAFATA
RGKWEYARQEVEYMFRQGRPVLVGTTSVENSEYLSDLLKERKIPHNVLNARPKYAAREAE
TVAQAGRKHAITISTNMAGRGTDIILGGNPKMLAKEIIEDSLLSFLTKESPDYEIDGEEL
SRKVLSKINVGSSSLALLAKTALMAKYVCKNEGRNWTYKEAKSIILESVEMSQSMSFKEL
ERLADEQIETYPLGPTVALAYLSVLEDCEVHCSKEGAEVKRLGGLHVIGTSLHESRRIDN
QLRGRAGRQGDPGSTRFMVSLQDEMFQKFNFDTEWAVRLISRITNDEDIPIEGDAIVKQL
LALQINAEKYFFGIRKSLVEFDEVLEVQRKHVYNLRQSILTGNNESCTQHIFQYMQAVVD
EIVFSHVDPKKHPRSWRLGKLVQEFKTIGGKILEDLGAEITEEGLLKAIMKLHQTISTDV
CNLNLPEMPKPPNAFRGIRMKNSSLERWLSICSDDLTPNGRYRMIANLLRKYLGDFLIAS
YLNVIQESGYDDSYVKEIERAVLVKTLDCFWRDHLINMNRLSSAVNVRSFGHRHPLEEYK
IDGCRFFISVLSATRRLTVESLLRYWSSPMETQELIF
Download sequence
Identical sequences Cucsa.107060.1|PACid:16959552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]