SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cucsa.108170.2|PACid:16959698 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Cucsa.108170.2|PACid:16959698
Domain Number - Region: 116-173
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 0.0915
Family N-utilization substance G protein NusG, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cucsa.108170.2|PACid:16959698
Sequence length 375
Sequence
MLDQLYLESGILQKMIYKNKNQHRRSSYFRYLLQVRRDLRLLQAVKLEELLSSCFQVIDG
KKPKQKIHFLESLKRRKCEVGKYNFMERLLGAVRLLSQMVEPIFKAATEISILLARTFFP
GFCFVILALLARIRVLVQQILLDVVSVFNTVSSISKKKQVVAINQERIQVFREFYPTNDE
YVLLECIWEVDKFILKEKKNEIATKNQEEHIAPDFSLATSAMRYQKLRSFLGDDESEEAE
DDESEEADANQSNEKGLDLMKTTPNGLLASPSGSVNDISMEDNTETKDGLISPVKTTSKT
FLPQEGNSLVNSSPPMPSAKKPNSKRPAFVSVELPKPITSGAVGIQFNESKVDSVEKENP
FFTLLTGGKAKSSLF
Download sequence
Identical sequences Cucsa.108170.2|PACid:16959698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]