SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cucsa.139120.1|PACid:16963333 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.139120.1|PACid:16963333
Domain Number 1 Region: 20-97
Classification Level Classification E-value
Superfamily TSP9-like 1.31e-20
Family TSP9-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cucsa.139120.1|PACid:16963333
Sequence length 97
Sequence
MASLPIAFSPAAGRVFAATAAKGAGESKKEKGLLDWIIGSLNKDQLLETDPVLQKVEGKD
AASGNGTGSVRGGRKNSVQVPPKKNGGGFGGLFAKKD
Download sequence
Identical sequences A0A0A0KC59
XP_004143212.1.97903 Cucsa.139120.1|PACid:16963333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]