SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cucsa.002530.1|PACid:16950913 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.002530.1|PACid:16950913
Domain Number 1 Region: 512-634
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.26e-19
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cucsa.002530.1|PACid:16950913
Sequence length 700
Sequence
MEITYSSPSANSLSFSNSAMPTSGRPVKVIPLQHPTTSSSSTTGGFGAGTLVKSWTTKVK
RMTWIHWMELLLPCSRWIRTYKWREYLQSDLLSGITIGIMLVPQAMSYAKLAGLRPIYGL
YSGFLPLFVYAIFGSSRQLAVGPVALVSLLVSNVLGGIVNSSEELYTELAILLALMVGIL
ECTMGLLRLGWLIRFISHSVISGFTTASAFVIGLSQVKYFLGYDVSRSSRIIPLIESIIA
GADGFLWAPFIMGSAILAVLQIMKHLGKTRKHLRFLRVAGPLTAVVMGTTLAKVLNLPSI
SLVGDIPQGLPTFSIPKRFEHVKSLIPTAFLITGVAILESVGIAKALAAKNGYELDSNQE
LFGLGVANVVGSFFSAYPTTGSFSRSAVNHESGAKTSLSQIVTGIIMGGALLFLTPLFEH
IPQCALAAIVISAVITLVDYEEAIFLWRIDKKDFLLWVITAVATLFLGIEIGVLIGVGVS
LAFVIHESANPHMAVLGRLPGTTVYRNVQQYPEAYTYNGIVVVRIDAPIYFANTSYIKDR
LREYEVEVDQSTGRGPDVERVYFVIIEMAPVTYIDSSAVQALKDLYQEYKLRDIQIAISN
PNRDVLLTFSRSGVVELIGKEWFFVRVHDAVQVCLQHVESLNETTKTSDSSPKDKSSFLQ
SLVKSRSEDFSVSQLESGFQKLPSFNEIDPQLEPLLSRKP
Download sequence
Identical sequences A0A0A0KQT8
XP_004149828.1.97903 Cucsa.002530.1|PACid:16950913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]