SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cucsa.062730.1|PACid:16954961 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.062730.1|PACid:16954961
Domain Number 1 Region: 9-55,86-119,178-203
Classification Level Classification E-value
Superfamily POZ domain 1.22e-18
Family BTB/POZ domain 0.023
Further Details:      
 
Domain Number 2 Region: 288-372
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.07e-17
Family Ankyrin repeat 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cucsa.062730.1|PACid:16954961
Sequence length 483
Sequence
MTFEDSLRSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGSSSD
SNSSPGPVFDSRSPSGSNSRGSSGANSTSLPPQGVIPVNSVGYEVFLLLLQFLYSGQVSI
LPQKHEPRPNCGERGCWHTHCSSAVDLALETLAAARSFGVEQLALLTQKQLVSMVEKASI
EDVMKVLIASRKQDMHQLWTTCSHLVAKSGLPTEVLAKHIPLDVVAKIEELRLKSSLARR
SSLMPHHHHHHHHLQLSAAADLEEQKIRRMRRALDSSDVELVKLMVMGEGLNLDEALALH
YAVENCTREVVKALLELGAADVNYPAGPAGKTPLHIASEMVSADMVAVLLDHHADPTIRT
VDGVTPLDILRTLTSDFLFKGAVPGMTHIEPNKLRLCLELVQSAALVISREQGNNNNNNG
NNNASSSNPIYPPMSEDHSSSSNGSNLNLDTRLVYLNLGANSGSAQMGADGADHRHGGND
PTX
Download sequence
Identical sequences Cucsa.062730.1|PACid:16954961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]