SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cucsa.109990.1|PACid:16959968 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.109990.1|PACid:16959968
Domain Number 1 Region: 310-411
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-24
Family B3 DNA binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 31-122
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.43e-20
Family B3 DNA binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Cucsa.109990.1|PACid:16959968
Sequence length 417
Sequence
MDNSLTAMPESNEQEGAQSFNQTSPARRAGLFYKLVVPSILQDKKLKIPNKFAKKFGGDI
LDLVTLVAPNGYRWVLELKRHGRSMWFEDGWHEFVKHHCIQVGQLLVFRFEGNSVFNFYM
FNLTAIPNGPCNTSNASIEQNDGEQCPDTLGKEAEYKKLVEILGTGSPDPSPRPSVKDLV
CEFPDQQKFNGSCNGTSIKNFMHWFDTENLHPLKDFDNPLKHLDKLRMQLLNSNRDIGIQ
FDGDELAKARENHDFQLNQSSDEREEGAMKKKLKLEPIDYYNDNEPIDEKKCGNVPHKIN
RMAFGVEEFKFGNPFCWIVMRQSYIRRGFHLHIPSKFAEKYLKGVWGDITLQVSSGKQWR
VRCIREGPGTKLTRGWADFVVDNDLKEEDVCVFELINMKDIVMQVTVFRVHGDPTKT
Download sequence
Identical sequences A0A0A0LP18
Cucsa.109990.1|PACid:16959968 XP_004145348.1.97903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]