SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cucsa.109990.2|PACid:16959969 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.109990.2|PACid:16959969
Domain Number 1 Region: 299-400
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-24
Family B3 DNA binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 33-111
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.24e-18
Family B3 DNA binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cucsa.109990.2|PACid:16959969
Sequence length 406
Sequence
MDNSLTAMPESNEQEGAQSFNQTSPARRAGLFYKLKIPNKFAKKFGGDILDLVTLVAPNG
YRWVLELKRHGRSMWFEDGWHEFVKHHCIQVGQLLVFRFEGNSVFNFYMFNLTAIPNGPC
NTSNASIEQNDGEQCPDTLGKEAEYKKLVEILGTGSPDPSPRPSVKDLVCEFPDQQKFNG
SCNGTSIKNFMHWFDTENLHPLKDFDNPLKHLDKLRMQLLNSNRDIGIQFDGDELAKARE
NHDFQLNQSSDEREEGAMKKKLKLEPIDYYNDNEPIDEKKCGNVPHKINRMAFGVEEFKF
GNPFCWIVMRQSYIRRGFHLHIPSKFAEKYLKGVWGDITLQVSSGKQWRVRCIREGPGTK
LTRGWADFVVDNDLKEEDVCVFELINMKDIVMQVTVFRVHGDPTKT
Download sequence
Identical sequences Cucsa.109990.2|PACid:16959969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]