SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cucsa.179870.1|PACid:16967237 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.179870.1|PACid:16967237
Domain Number 1 Region: 267-375
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.64e-17
Family Ankyrin repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 62-188
Classification Level Classification E-value
Superfamily POZ domain 4.71e-16
Family BTB/POZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cucsa.179870.1|PACid:16967237
Sequence length 585
Sequence
MDNANDPSSSPSFASSSYVSNGSSYNNVAATFSNDPSANSDHMCLSKLSANLEKLVVDSD
FDYTDAVIVVEGIEVGVHRCILAARSQFFHELFKQEVDSSTEDGKPKYCMSKLVAFRKVG
IEAFKVILNYLYTGKLKPSPPEVSTCVDEACAHDACGPAINYAVELMYASATFKMKEMVL
LVQRRLLNFVEKAAVEDVITLLIAAFHCHLDQLHTPCIQRVARSNLDAVSLGRELPDEIA
SEIKSLRMKSQQETEPDIVEEADLNREKKIRRLHKALDSDDVELLGLLLRESSDITLNDA
YALHYATAYCDPKVIKEVLNLGLADLNHKNLRGQTVLHVAARRKDPNIIVALLDKGASAL
EPTADGQTAVTICRRLTRPRDFNETTQKGQVSNKDRLCIDVLEREMRRNSFSSGMEMATQ
ISATDMHVMLDYLENRVAFARLFFPAEAKVAMEIADAGSTIAYIGPVPAKGSSGNLLKVD
LNETPSVGTKRLQSRMQALMKTVETGRRYFPHCSEVLDNFLADDMPDLLFLETGTPEEQR
KKKARFMELKDDVQKAFCKDLASSLSSSSSSSSPKVGINHKARRK
Download sequence
Identical sequences Cucsa.179870.1|PACid:16967237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]