SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cucsa.198800.1|PACid:16968635 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.198800.1|PACid:16968635
Domain Number 1 Region: 291-626
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.88e-86
Family IF2B-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Cucsa.198800.1|PACid:16968635
Sequence length 645
Sequence
MDARRGSRVVNPKIRQVGFFTLDPPNPPGRSLSGPADCTPSQQSLSPPSNSLSPVMIPPP
RHLSDNLASRSAVFPLPPPANWRDSADHIHVGSYNPSEMLLATSPSGRIGDEELDMSEDS
FTSVPYRRSGSGKIASSFPGVGIYMAAKASETSQAMVPNTVEANKSVGVAEKNGGASTEL
QNRQPPSNSKPQKAKTTKAERRALQEAQRAAKGEAKKSSNAPGKAVKQSSTMRDSTAAPS
VASTDKRGGDRTHDKERKKDAPPPRMQFDDKSRVEKAKKRAVFNQTEARNRVELFRHLPQ
YEQGTQLPDLVSKFFQLDPIHPAIYKVGLQYMAGDICGGNARCIAMLHAFQQAIKDYSTP
PQKSLGRDLTTKIGGYVSFFNECRPLSVSMGNAIRFLKNLIAKLPLNLPESEVKATLCSD
IDRFINEKIIIADEVIVRHAATKIRDGDVLLTYGSSCAVEMLLLYAHELGKEFRVVVVDS
RPKLEGQALLRRLIGRGLSCTYTHINAISYMMHKVTRVFLGAAAVLSNGTVYSRVGTAAV
AMVANAFHVPVLICCEAYKFHERVQLDSICFNELGDPDAISKVPGRKDINHLENLAAKEQ
LQLLNLMYDATPSDYISMIVTDYGMVNLVQSLSGTCSYIYLYSCL
Download sequence
Identical sequences Cucsa.198800.1|PACid:16968635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]