SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cucsa.198800.2|PACid:16968636 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.198800.2|PACid:16968636
Domain Number 1 Region: 291-638
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 2.86e-90
Family IF2B-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cucsa.198800.2|PACid:16968636
Sequence length 645
Sequence
MDARRGSRVVNPKIRQVGFFTLDPPNPPGRSLSGPADCTPSQQSLSPPSNSLSPVMIPPP
RHLSDNLASRSAVFPLPPPANWRDSADHIHVGSYNPSEMLLATSPSGRIGDEELDMSEDS
FTSVPYRRSGSGKIASSFPGVGIYMAAKASETSQAMVPNTVEANKSVGVAEKNGGASTEL
QNRQPPSNSKPQKAKTTKAERRALQEAQRAAKGEAKKSSNAPGKAVKQSSTMRDSTAAPS
VASTDKRGGDRTHDKERKKDAPPPRMQFDDKSRVEKAKKRAVFNQTEARNRVELFRHLPQ
YEQGTQLPDLVSKFFQLDPIHPAIYKVGLQYMAGDICGGNARCIAMLHAFQQAIKDYSTP
PQKSLGRDLTTKIGGYVSFFNECRPLSVSMGNAIRFLKNLIAKLPLNLPESEVKATLCSD
IDRFINEKIIIADEVIVRHAATKIRDGDVLLTYGSSCAVEMLLLYAHELGKEFRVVVVDS
RPKLEGQALLRRLIGRGLSCTYTHINAISYMMHKVTRVFLGAAAVLSNGTVYSRVGTAAV
AMVANAFHVPVLICCEAYKFHERVQLDSICFNELGDPDAISKVPGRKDINHLENLAAKEQ
LQLLNLMYDATPSDYISMIVTDYGMIPPTSVPVIVREYRREHLWI
Download sequence
Identical sequences A0A0A0LSL4
XP_011648725.1.97903 Cucsa.198800.2|PACid:16968636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]