SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cucsa.265930.3|PACid:16973326 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.265930.3|PACid:16973326
Domain Number 1 Region: 65-93,132-607
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.3e-91
Family Acetyl-CoA synthetase-like 0.00000842
Further Details:      
 
Domain Number 2 Region: 830-1089
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.71e-32
Family Quinoprotein alcohol dehydrogenase-like 0.013
Further Details:      
 
Domain Number 3 Region: 625-688
Classification Level Classification E-value
Superfamily ACP-like 0.000000216
Family Peptidyl carrier domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Cucsa.265930.3|PACid:16973326
Sequence length 1107
Sequence
MKQPLCCISHEFQRVALSHPGKIAVIHASGGVQLFRQLHGAGGGGEADDFFQGRATSSFP
PMYEADRCFTYSQLLASVDSLSSRLLATVRGPQLNAPTAPRPANDQPAKTSPVASELSEA
STELESSNIPKIFGIYMPPSVEYIISVLSVLRCGGAFMPLDPAWPKRRILSVVSSLKIDL
IIYSGSSFCVDGYHVTEGFRWLEEISGYSTLCFNMEESSVREHNSAVDLVFPCEDEKARL
FCYVMYTSGSTGKPKGICGTEQGLLNRFQWMQENFPSTREELLLFKTSISFIDHIQEFLS
AILTASVLVTPPMKELKENLCSVVNFIQAYSISKLTAVPSLMRTLLPALQRFCGVKCSLR
LLILSGETLPILLWDALVKLLPETTILNLYGSTEVSGDCTYFDCKKMPMILETDAIKTVP
IGVPISHCDVVVVGDNDALNLGELCVGGPCVCSGYYSDSVFLPLDGIKFSQDFIHEGSFN
VTCSQIYIRTGDFVQQLRSGDLVFLGRKDRIIKVNGQRISLEEIEDALREHPDVVDAAVV
SRKSDWELEYLVAFLVLKDNEKSEVFRSTVRSWMVEKVPLAMIPNSFFFTDSIPMTTSGK
VDYEMLTHSRPLWEQVHESIDETWANEFIQIIKKAFSDALMVEEISSGDDFFTMGGNSIT
AAHVSHRLGIDMRWLYHYPSPAKLLTVILEKKGLDIISINEDADSRRNLKTDRWNKYSLD
DSEFLNHFDLKEGGSSGKRKQVQPNGDFSRAVVPRNNNSLLSKHYKAVSDCSINLENISQ
VGGHLWHSPLTSVSCAFSRCNKVVYEHKYIGDNKRAGTLLVKSPRGENGSMKKLWQVHME
SCVDASPLLVFKHPNIYLFIGSHSHKFVCVDAKNASLRWEIRLEGRIECSAAIVGDFSQV
VVGCYKGNIYFLEFSTGVILWTFQTSGEVKSQPVVDPDRNLIWCGSYDHNLYALDYVRHS
CVYKLPCGGSLYGSPAIDGVQHRLYVASTGGRISALLIKDFPFNSLWHYDLEAPVFGSLA
IDPVTRNVICCLVDGHVVALDSSGSVSWKSKTGGPIFAGPCISTSIPSQVLICSRNGRIY
SFELSTWSTLLSKSCVFCWDLLRKVEI
Download sequence
Identical sequences Cucsa.265930.3|PACid:16973326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]