SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cucsa.317610.1|PACid:16977152 from Cucumis sativus v122

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cucsa.317610.1|PACid:16977152
Domain Number 1 Region: 7-95,176-406
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.07e-82
Family IF2B-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Cucsa.317610.1|PACid:16977152
Sequence length 416
Sequence
MPDVQAIVNDFVIKLMKRKIEGSLATAKHTAELLRSVISAQRIPYTNQAAALIDAVKAVG
EQLIAANPVELAVGNIVRRVLHIIREEDLSLTTASIAGLSLSAVSDDEDDIEKDDRPVLS
AAAVAAAARSTLRPPSLQTLLEDVPNQTSVHQTSSSGGDSEGKSKSADKSSRSRKLKHDV
IEAVNELIQDIATCHEQIAEQAVEHIHQNEVILTLGSSRTVLEFLCAAKEKKRSFRVFVA
EGAPRYQGHLLAKELVTRGLQTTLITDSAVFAMISRVNMVIVGAHAVMANGGVMAPVGLN
MVALAAKRHAVPFVVLAGSHKLCPLYPHNPEVLLNELRSPSELLDFGEFSDCMDFGTCTG
SPLLHVVNPTFDYVPPSLVSLFITDTGGHNSSYMYRLIADYYSADDLVIKRSSTGS
Download sequence
Identical sequences A0A0A0KNF8
Cucsa.317610.1|PACid:16977152 XP_004143752.1.97903 XP_011655262.1.97903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]