SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspwe1|167395|gm1.1330_g from Aspergillus wentii v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspwe1|167395|gm1.1330_g
Domain Number 1 Region: 158-562
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.02e-104
Family GABA-aminotransferase-like 0.0000000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspwe1|167395|gm1.1330_g
Sequence length 645
Sequence
MESLLQQSRAMCPFLKRTSPAALRTLSTATRPSTSPGGGTMSNLQVLARRCPVMSKALAV
QSSRLAGTKRFTSSAAGVTGLNNKYFRAHQTNRALHTTAGNGASLSEESYKKNERVHPSL
VNTPAAPAADVTSTLTGPRPHAPSTTRFNYNDFYNAELEKKHKDKSYRYFNNINRLAKEF
PRAHTTSSEERVTVWCSNDYLGMGRNPEVLNSMHQTLDNYGAGAGGTRNISGHNKHAVAL
EDTLAKLHGKEAALVFSSCFVANDATLATLGSKMPDCVILSDSLNHASMIQGIRHSGTKK
MVFKHNDLVDLEAKLASLPLHVPKIIAFESVYSMCGSIAPIEKIQDLADKYGAITFLDEV
HAVGMYGPHGAGVAEHLDYDAYASLDTANPRSTKGTVMDRVDIITGTLGKAYGCVGGYIA
GSAAMVDTIRSLAPGFIFTTSLPPATMAGADTAIKYQAQHQGDRVLQQLHTRMVKDSFKE
LDIPVIPNPSHIVPLLVGDAEVARQASDMLLEEHGIYVQAINYPTVPRGEERLRITPTPG
HVKEHQDHLVQAVQDVWQKLNIKRASDWEALGGFVGVGVEGAEADNMPMWEDGQLGLRSN
ETLQAAVDRAFQNEKPAVASQPRMQTATPIQPAVTMASTPVGVAA
Download sequence
Identical sequences A0A1L9S2J5
jgi|Aspwe1|167395|gm1.1330_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]