SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspwe1|26575|fgenesh1_pg.3_#_815 from Aspergillus wentii v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspwe1|26575|fgenesh1_pg.3_#_815
Domain Number 1 Region: 12-21,55-176,212-322
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.19e-22
Family TTHA0625-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspwe1|26575|fgenesh1_pg.3_#_815
Sequence length 406
Sequence
MPNSNTTRVFSLNFIGDIMLGRLIDQLWPQHVDNPHDHRTITNFLDNYPYLESYTPKSPW
GTALPLFHTSDLNLINLETAVTTSPEPWPNKAFNYRMHPANVAALHEARIDYANLANNHV
LDFGTEGLVETVWTLRESRIAFSGAGERTKEAVSGTVVRLPRVEKEGGKVARASSVSASA
SASASQRQKGDDSEKQEHYQIHISSASDHPSSWSDIPTFHFIDYTSSTRQSLKSLLTSPS
SQSAALKIFSVHWGPNYAWRPDSQIRSMAHFLVDECGVDIVHGHSAHHVQGVERYKGKLI
IYGCGDFVDDYALNEQFRNDLGGVWRVWVRGVEGDGDGGKVKKLGLDRLEIFPTRCDRFQ
VTLLNRADEDHGWVRRRITKLTEEMGTKVRKDLGEEGQIVIDLDVD
Download sequence
Identical sequences A0A1L9RQD4
jgi|Aspwe1|26575|fgenesh1_pg.3_#_815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]