SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspwe1|27953|fgenesh1_pg.4_#_621 from Aspergillus wentii v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspwe1|27953|fgenesh1_pg.4_#_621
Domain Number 1 Region: 201-616
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.15e-94
Family GABA-aminotransferase-like 0.00000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspwe1|27953|fgenesh1_pg.4_#_621
Sequence length 680
Sequence
MPRRSANSPSAQDTPNSPSFSSASGKGGIAIKAPITITNRFSQLFSTSPKSKAEPPQTAQ
AVLHSVSGNLHSSPAAPPISSASLSLPTISLSTATADNPNMDEPPTTLFQPPSAEEARRL
AKQHAQFGPIGHHSHRYSSRHPGGVFPEPVMDEPPYYYLLTTYISYLILIAFGHVRDFFG
KRFREENYRHLKPRNGYGALNSDFDNFYVRRLKLRINDCFERPVTGVPGRYITLIDRATD
DHNKHFYLTGTTTDTLNLSSYNYLGFAQSEGPCADYAEEIMRKYGISTPSTRAEVGTQDL
HAEVEDLVAKFVGKEASMVFSMGFGTNANIFPALVSKGCLIISDELNHASIRFGARLSGA
SIGMFKHNDMRDLEARLREAICQGQPRTHRPWKKILVVVEGLYSMEGSMCNLPGLIALKR
RYKFNLFVDEAHSIGAIGPKGRGVCDYFSIDTSEVDILMGTLTKSFGANGGYIAADKEMI
YKLRATDSGVLYGESPAPAVLAQISSALRLINGELIPGQGEERLQRLAFNSRYLRLGLKR
LGFIVYGHDDSPIIPVLLFNPAKMPAFSHEMLKRKISVVVVGYPATPLVSSRARFCVSAA
HTKDDLDRILTASDEIGNVLQLKFSTGIAGGALPDNGDMTPPPEMEKEWRRKRNPNIIPP
RWQIEDVIRRGVQDVKSPLF
Download sequence
Identical sequences A0A1L9RK76
jgi|Aspwe1|27953|fgenesh1_pg.4_#_621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]