SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspwe1|28191|fgenesh1_pg.4_#_859 from Aspergillus wentii v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspwe1|28191|fgenesh1_pg.4_#_859
Domain Number 1 Region: 204-483
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.37e-111
Family Protein serine/threonine phosphatase 0.0000000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspwe1|28191|fgenesh1_pg.4_#_859
Sequence length 510
Sequence
MGQSHSKNNSGSGDSLQSYPSFSRSDTKESLRSLRGSIRSKIRSSDSPRASTTGLSQVDS
QTDKSDAGSVRSTGTASRPGSSLNSPGPDGDSRPASPQPPPSPSLSTSLKRGHQDVDAMQ
QSGEVDHVSDVPPSGEAPSATPGKVGESILIKRENQLNPILDFILNAPLETNGSPGMGMG
ALKSIDLDDMISRLLDAGYSTKVTKTVCLKNAEIMAICTAARELFLNQPALLELAAPVKI
VGDVHGQYTDLIRLFEMCGFPPTSNYLFLGDYVDRGKQSLETILLLLCYKLKYPENFFLL
RGNHECANVTRVYGFYDECKRRCNIKIWKTFIDTFNCLPIASIVAGKIFCVHGGLSPSLS
HMDDIRGIARPTDVPDYGLLNDLLWSDPADMEEDWEPNERGVSYCFGKKVIMDFLQRHDF
DLVCRAHMVVEDGYEFYQDRILVTVFSAPNYCGEFDNWGAIMSVSDELLCSFELLKPLDS
TALKNHIKKGRNKRNSLLNSPPAMVSAQSY
Download sequence
Identical sequences A0A1L9RKW8
jgi|Aspwe1|28191|fgenesh1_pg.4_#_859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]