SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspwe1|387386|CE198866_35372 from Aspergillus wentii v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspwe1|387386|CE198866_35372
Domain Number 1 Region: 20-302
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 3.07e-117
Family Protein serine/threonine phosphatase 0.000000000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspwe1|387386|CE198866_35372
Sequence length 324
Sequence
MADQEVDLDSIIDRLLEVRGSRPGKQVQLLESEIRYLCTKAREIFISQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFVL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDLN
SMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKHDM
DLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAEK
KQKYVYGGTGSGRPITPPRKQKKK
Download sequence
Identical sequences A0A1L9RXS1
jgi|Aspwe1|387386|CE198866_35372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]