SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspwe1|50802|fgenesh1_pm.3_#_992 from Aspergillus wentii v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspwe1|50802|fgenesh1_pm.3_#_992
Domain Number 1 Region: 16-314
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 9.42e-123
Family Protein serine/threonine phosphatase 0.000000000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspwe1|50802|fgenesh1_pm.3_#_992
Sequence length 329
Sequence
MDNNMEIDTARSPEPHLLSPITDTGSIPTLDGWIENLMTCKQLAEEDVRRLCDRAREVLQ
EESNVQPVKCPVTVCGDIHGQFHDLMELFRIGGPNPDTNYLFMGDYVDRGYYSVETVTLL
VCLKIRYPQRITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALIE
NQIFCLHGGLSPSIDTLDNIRSLDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTF
GQDISEAFNHNNGLTLVARAHQLVMEGYNWSQDRNVVTIFSAPNYCYRCGNQAAIMEIDE
HLKYTFLQFDPCPRAGEPMVSRRTPDYFL
Download sequence
Identical sequences A0A1L9RRZ4
jgi|Aspwe1|50802|fgenesh1_pm.3_#_992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]