SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspwe1|68450|estExt_fgenesh1_pg.C_4_t10374 from Aspergillus wentii v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspwe1|68450|estExt_fgenesh1_pg.C_4_t10374
Domain Number 1 Region: 32-197,290-410,444-534
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.49e-59
Family Pyridoxal-dependent decarboxylase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspwe1|68450|estExt_fgenesh1_pg.C_4_t10374
Sequence length 1134
Sequence
MAVRAHANNGEDQITNQNVINNYFIGPRASNMPDFRANINTVLDELLETRLDYYPEDNNQ
KFITKEVRRSKEFQRVRDNFGDVVRKVAQLLGEHSVPFWSPRYEAHMCTDLTMPSLLGYF
MTMLYNPNNVALEASPMTTVAELLVGQQLCGLFGYRTPHTPDPKGKRKQEEPLSWGHITC
DGTVANLESIWVARNLKFYPLNLYLAIKYGKLKFIADKFEVETLTDGKKKFASLKTWDLL
NLKPKTVLDLPDLLFENYGISSDFLKDALEPYNIQSAGLMHKETDEENSTPETKEIDKFY
RSLKPMKFILSKTRHYSWPKGLAIAGLGSGNLLEVEVDDDAHIDLVQLEEKLEYCLDKKI
PVYAVVAIIGSTEEGAVDRLSKIIDLREKFQKRGLSFIVHADAAWGGYFATMLHRSRDGR
PEQGGADRGAVPALTLRKETEEDLIALQHADSITVDPHKAGYVPYPAGSLVYKDGRMRYL
VTWSSPYLSQGSSENIGVYGVEGSKPGAAAMSTWLSNQTIGLDPDGYGKLLGQASFTSSR
LSVRYAVHSNFKQGERKPFICVPLNRLPKEREGFAFNSDEVEGDRDEIRKKILGKDNEVL
MKHPDAMKLLRELGSDTNINAFSLNFYLKKEKDEKEENTKLNTDVEEANYLMKRVVDRLS
ITTANTDPTKIPVYLTSTKFEQELYGKCAKNFMKRLGLAEVDEDLFVLRNVVMSPFPTKH
YFIGKLWDEFEKVVNQEVRRVRTRNDPAAHKAQFLLQGTDKIFLVLQTSFHTATLRQQLI
VRADLDDELKQKYVKLKGDNPETSLLLVSRGKINLKEGIEKIESLPGKTFEFGAEIFKKA
DYLNNPEYYRHDPDLYLRNLNAYRHDPKQFLRNLDEYIQNTEEYLRHPEKYVHNPDDFSQ
VLEEQIEDVGEYLHNLKEYFAKLKDPKEPTKSLAQGKVKITRDGIIKSRPLNSINRDLKY
PQENMPFYLYGTPDHVHISHVLVRAPNIALSAANVKLSIFAGVEDRLSADDLSKGLILGL
TEKPEVAMQPFSGQVSATAESPDETFFFRSGKKFQVNIWRDKKASNAAGPGLLNDLGDPF
WSGTLTLGNDVDYDSEWPNKDPAATQKVDADRWQTELRSIGNVLNAGYVDPPAE
Download sequence
Identical sequences A0A1L9RJK1
jgi|Aspwe1|68450|estExt_fgenesh1_pg.C_4_t10374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]