SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspwe1|747212|MIX17023_63_57 from Aspergillus wentii v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspwe1|747212|MIX17023_63_57
Domain Number 1 Region: 25-178,269-387,425-512
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.41e-57
Family Pyridoxal-dependent decarboxylase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspwe1|747212|MIX17023_63_57
Sequence length 1022
Sequence
MSFEGTKQFNVINSYFIGPKAANLPDFRANINTILDELLEARMDYWPADNHRKFIPKDVR
TSEEFRRVRDNVSDAVRKVAALMGKHSVPFWSPRYQGHMCTDLTMPSMLGYFMTMIYNPN
NVALEASPITTVAELKVGQQLCELFGYNIKDEPLPWGHITCDGTVANLESIWVARNLKFY
PLALKWAIEKGKLQFIKDEFKVHPCSSDLKNPNEKELFVKMDNWTLLNLRPETVLGLPEA
LGKEFGISTPFLESALEEYNIQTGGRGPLEEYHKLPKEMKEMKYLLGTTRHYSWPKGLAI
AGIGSGNLTEIEVDLNAHINIKKLDEQLHTYAKKKIPVYAVVAIIGSTEEGAVDRLSQIV
KIRKTLQEKYGMSFLIHADAAWGGYFSTMIDKEHPELIGKETKYRNFKKGPVPALTLKKD
TEEDLFALKDADSITVDPHKAGYVPYPAGSLVYRDGRMRHLVTWSSPYLSQGSSENIGVY
GVEGSKPGAAAMSTWLSNKTIGLDPHGYGMLLGEAAFTSARTVVHGVEQETPIYNKDFIC
VPFNRLRCEKDDGKPFSSPEFEEERNWIREHILGKENGEIMKNNDAMERLRELGSDLNIN
AFALNWYYEDGTLNTDLEEANYLMKRVVDRLSIISADTDPSQIPLYLTSTKFEPKLYGKC
AQNFMSRLGVKPCKQDLFVLRNVVMSPFPTQQNFIGELMECFEEVVRDEVKNCRKRNSKD
AHDAKFIIRGTKQVYLDLQTSFHTATLRQQLIVAADLLGNLKAHYDSLVDDKPEETMILE
AAEKIDLKAMIGDLSTAQFKVKVYSKENPASFKEGEVKLTKIVKSRPLNTLNRDTDYPEN
NTPFYLYGVKNEPEEVLGGEQQEPPEAHVSHILLKAPNIALSANGVTFDPPLDSDTKNEL
PNGLILTLSKYPEAAMQPFPSSNKDLPPSFFFRSNRKYDVKVWKDPKAAEAEGPGLLKDL
ENPDNGPMYEGKMTLGLDVDVDAAGPNLDKIDADKKLDCTKWQKELDSIGNVLNGNHVDS
RH
Download sequence
Identical sequences A0A1L9R8T1
jgi|Aspwe1|747212|MIX17023_63_57

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]