SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|19740|e_gw1.19.138.1 from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|19740|e_gw1.19.138.1
Domain Number 1 Region: 5-219
Classification Level Classification E-value
Superfamily Hsp33 domain 6.54e-49
Family Hsp33 domain 0.0000145
Further Details:      
 
Domain Number 2 Region: 239-282
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 0.0000000000327
Family HSP33 redox switch-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|19740|e_gw1.19.138.1
Sequence length 290
Sequence
RSVSGAGEVSIMVVRGTDLVQEACTRHRTAPTASAALGRALLGTLLMGCFRAEGEATQVT
FKGDGLLGGIQVVADALGNVKGKVGDPSADPPLRPDGKLDVGSAVGRGVLSVVRSNIAQE
KPYTGLTEIKTGEVGDDLAAYMADSEQVNCALALGVSINRDCSVRAAGGYLIQVLPFASE
ETLELLERNIAASPSVTDLLHEGASPRDIADRLLSGLGVSDGGPAIQPRYGPCEAESLKE
RMKRAVALLGPKEVQEILATQGKIEVSCEFCRETYQFAQDEVLAAAPAQQ
Download sequence
Identical sequences I0YLM2
jgi|Chlvu1|33295|e_gw1.19.135.1 XP_005643835.1.71052 jgi|Coc_C169_1|19740|e_gw1.19.138.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]