SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|28069|estExt_Genewise1Plus.C_40653 from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|28069|estExt_Genewise1Plus.C_40653
Domain Number 1 Region: 15-144,411-537
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 1.44e-83
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.00024
Further Details:      
 
Domain Number 2 Region: 212-384
Classification Level Classification E-value
Superfamily GroEL apical domain-like 2.62e-48
Family Group II chaperonin (CCT, TRIC), apical domain 0.00014
Further Details:      
 
Domain Number 3 Region: 149-218,377-411
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 7.32e-30
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|28069|estExt_Genewise1Plus.C_40653
Sequence length 548
Sequence
MAGIQGIGGLQIQGERTSGQDVRTQNVTAVAAIANIVKSSLGPVGLDKMLVDDIGDVTIT
NDGATILNLLEVEHPAAKILVELAELQDQEVGDGTTSVVIVAAELLKRANDLVRKKIHPT
SIISGYRLAMREACKYIEEKLAIPTSSLGKETLLNAAKTSMSSKITGGDSDFFAHMAVDA
VQSVKTVDSSGKEVYPVKSINVLKAHGKSARESALLNGYALNMGRASQGMPKRVANAKIA
CLDMNLQKARMHMGIQVLIDDPKELEKIRDRESDITKERIQKVLDAGANVVLTTKGIDDM
SLKYFVEAGVIACRRVPKEDLRRVAKATGAQMVLTLADMDGNETFDASALGTAEEVVEET
VADDDMVMIRGSSNTRACTVLLRGANDYMLDEMDRSLHDAFCVVKRVLESGNVVAGGGAV
EAALSIYLENFATTLGSREQLAIAEVADALLVIPKCLAVNAAKDATELVAKLRAYHYTAQ
TKPDKAALARYGLDLVKGVLRNNVEAGVIEPVLSKIKMIQFATEAAITILRIDDMITIEA
SAEDEMEG
Download sequence
Identical sequences I0Z4E1
jgi|Chlvu1|41769|estExt_Genewise1Plus.C_40706 jgi|Coc_C169_1|28069|estExt_Genewise1Plus.C_40653 XP_005650054.1.71052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]