SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|30283|estExt_Genewise1Plus.C_130148 from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|30283|estExt_Genewise1Plus.C_130148
Domain Number 1 Region: 19-147,408-530
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 2.62e-85
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.0005
Further Details:      
 
Domain Number 2 Region: 212-381
Classification Level Classification E-value
Superfamily GroEL apical domain-like 1.78e-45
Family Group II chaperonin (CCT, TRIC), apical domain 0.00027
Further Details:      
 
Domain Number 3 Region: 154-216,371-407
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 9.16e-26
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|30283|estExt_Genewise1Plus.C_130148
Sequence length 565
Sequence
MAMGMMQPQIILLREGTDTSQGTAQLISNINACMAVTDTVRTTLGPRGMDKLVHDDRGTV
TISNDGATIMKLLDIVHPAAKVLADISMSQDAEVGDGTTTVVILAGELLKECKAYVEEGV
HPRAIIKAFRSAANLAVQQVKDSSISIAGKDEEEKRDMLQKCASTTLNSKLVSGEKEFFA
KMVVDAVSKLDPATLDMSLLGVKKVQGGGLRDSFLVDGVAFKKTFSYAGFEMQPKAYTDP
KVLLLNIELELKSEKENAEIRLSDPSQYQSIVDAEWNIIYDKLQKCADSGAKVVLSRLAI
GDLGTQFFADRDIFCAGRVAEEDLKRVASATGASVQTTVNNLDTNVLGTCEQFEEVQVGA
ERFNLFMGCPKAKTATMVLRGGSDQFIDEAERSLHDAIMIVRRAIKNAAVVAGGGAIDME
ISRRLRDHARTIAGREQLFMIAFARALEIIPRQLCDNAGFDATDVLNKLRQKHALKDGSG
KHFGVDVNTGGVVDTYGSFVWEPAVVKINALTAAAEAACLVLSVDETVRNPRSQPPDASG
GGAMGGRGNPMMRGRGRGRGRGMRR
Download sequence
Identical sequences I0YRU9
jgi|Coc_C169_1|30283|estExt_Genewise1Plus.C_130148 jgi|Chlvu1|44035|estExt_Genewise1Plus.C_130177 XP_005645662.1.71052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]