SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|36901|fgenesh1_pm.9_#_158 from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|36901|fgenesh1_pm.9_#_158
Domain Number 1 Region: 184-376
Classification Level Classification E-value
Superfamily GroEL apical domain-like 2.01e-71
Family GroEL-like chaperone, apical domain 0.00000407
Further Details:      
 
Domain Number 2 Region: 9-135,406-524
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 2.75e-70
Family GroEL chaperone, ATPase domain 0.00011
Further Details:      
 
Domain Number 3 Region: 141-203
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 9.16e-17
Family GroEL-like chaperone, intermediate domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|36901|fgenesh1_pm.9_#_158
Sequence length 546
Sequence
MAKELHFNRNMEALKKLQAGVDKLSSVVGVTLGPKGRNVVLESKYGSPRIVNDGVTVAKE
VELEDPVENIGAKLVRQAASKTNDTAGDGTTTATILSAAIIAEGMKIVAAGTNPIQLTRG
IEKTVTALVEELQKLSVEVRDEDLANVATVSAGGNEVIGQLISDAMGRVGRQGVVTMEES
RTAEDHLYVVEGMQFERGYISPYFVTDPERMVGEFENCRLLLVDKKISTARDIVGILEAA
VRGGFSLLIMAEDIEQEALATMVVNKLRGTLKVIAVKAPGFGERKSSYLEDIAIMTGAQV
VKEELGLSLDKVGEEVLGIAAKVTVSKESTTIVGDGRAEASVAARVRQIKNMIAETEQDY
EREKLNERVARLSGGVAVIQVGAQTETELKEKKLRVEDALNATKAAVEEGIVIGGGCTFL
KLARKVDEVKETLENDEQKVGAEIVRRALSYPLRLIANNAGVNGSVVQQKVLENLDANVG
YNAATDVYEDLMAAGIIDPTKVLRVAMLNAASVAKVFLTSDVIITEIPQPEGAAQAGAGM
DAMGGY
Download sequence
Identical sequences I0YWY2
XP_005647445.1.71052 jgi|Coc_C169_1|36901|fgenesh1_pm.9_#_158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]