SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|36959|fgenesh1_pm.10_#_47 from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|36959|fgenesh1_pm.10_#_47
Domain Number 1 Region: 198-390
Classification Level Classification E-value
Superfamily GroEL apical domain-like 7.92e-79
Family GroEL-like chaperone, apical domain 0.00000132
Further Details:      
 
Domain Number 2 Region: 21-148,420-542
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 4.81e-73
Family GroEL chaperone, ATPase domain 0.0000188
Further Details:      
 
Domain Number 3 Region: 152-217
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 9.84e-24
Family GroEL-like chaperone, intermediate domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|36959|fgenesh1_pm.10_#_47
Sequence length 568
Sequence
MQSFGRALVHSARKSRSKEVRFGVDCRSGVLAGVDKLADAVQVTLGPKGRNVVIEQSYGG
PKITKDGVTVAKSIELKDKFQNVGASLVKQVASATNDVAGDGTTTATVLTRAIFSEGCKS
VAAGMNPMDLRRGINLAVEKVLEDLKSRAKMISTTEEIAQVGTISANGEKEIGELIARAM
ERVGKEGVITVADGKTLENELEVVEGMKFDRGYISPYFITDPKTMKAELDNPYILIVEKK
VSGLAPLLPILESVIKTQRPLLIIAEDVESEALATLIVNKLRAGVKLAAVKAPGFGDNRK
ANLQDIATLTGGEVVSEDVGLSLDKIDMSKLGTAKKVSISKDDTIILDGGGEKDKINERC
DQIRESVAASSSDYDKEKLQERLAKLSGGIAVIKVGGASEVEVSEKKDRVVDALNATKAA
VEEGIVPGGGVALLYASKILGGIKGGLNFDQKIGVDIVERALSVPLKTIANNAGVEGAVV
AGKLLEKSDEENLGGRLGYNAATDKFEDLVAAGVIDPVKVVRTALVDAASVSSLMMTSEA
IVVDSPEEKAPAGSPGGMGMGGGYGDMY
Download sequence
Identical sequences I0YV02
jgi|Coc_C169_1|36959|fgenesh1_pm.10_#_47 XP_005646765.1.71052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]