SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|38097|fgenesh1_pm.18_#_50 from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|38097|fgenesh1_pm.18_#_50
Domain Number 1 Region: 14-141,406-524
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 9.29e-76
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.00078
Further Details:      
 
Domain Number 2 Region: 204-379
Classification Level Classification E-value
Superfamily GroEL apical domain-like 1.28e-48
Family Group II chaperonin (CCT, TRIC), apical domain 0.00018
Further Details:      
 
Domain Number 3 Region: 142-208,370-405
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 1.31e-23
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|38097|fgenesh1_pm.18_#_50
Sequence length 532
Sequence
MSSVKTLNSKAEVMGRGAALFMNINAAKGLHDVMRSNLGPKGTIKMLVGGSGDIKLTKDG
NVLLREMQIQNPTAVMIARTAVAQDDITGDGTTSTVLLIGELMKQAERYLNEGCHPRVIA
EGYEHAKKAALEFLDGFKEKLDVEDKEILRCVARTSLRTKLYEDLADQLTDIVVDAVLTI
RKPDEPIDLFMVELMHMKHKLDKDTRLVKGLVLDHGSRHPDMPKRLDDAHILTCNISLEY
EKSEVNAGFFYSSADQREKLVAAERAVVDTRVQKIIDLKRQVCKETGQGFVVINQKGIDP
MSLDMLAKEGILALRRAKRRNMERLTLACGGFAVNSVEELAPDVLGHAGQVYEHILGEEK
YTFVEDVRNPHSCTILIKGPSDYSLAQIKDAIRDGLRAVTNALADGAVVPGAGAFEVAAA
NHLQEVTRKEVEGRAKLGVAAFAEALLGIPKILAENSGYDAQDTIIALGEEAAKGNKVGL
DVATGEPLDPVLAGIYDNFLVKRQMLQSAPVVASQLLLVDEVIRAGMNMRKA
Download sequence
Identical sequences I0YML8
jgi|Coc_C169_1|38097|fgenesh1_pm.18_#_50 XP_005644181.1.71052 jgi|Chlvu1|33010|e_gw1.18.56.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]