SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|44765|fgenesh1_pg.19_#_147 from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|44765|fgenesh1_pg.19_#_147
Domain Number 1 Region: 14-143,406-526
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 8.5e-87
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.000094
Further Details:      
 
Domain Number 2 Region: 211-379
Classification Level Classification E-value
Superfamily GroEL apical domain-like 4.97e-49
Family Group II chaperonin (CCT, TRIC), apical domain 0.000000883
Further Details:      
 
Domain Number 3 Region: 143-215,370-405
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 3.05e-26
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|44765|fgenesh1_pg.19_#_147
Sequence length 557
Sequence
MQVPVAAVLNANTKRDTGKKAQHGNIAAAKAVADIVRTTLGPRAMLKMLLDASGGIILTN
DGNAILREIDVAHPAAKSIIELSRTQDEEVGDGTTSVIILAGEMLHVAEPFLERNLHPTV
IIRGYVKALEDALSIVDELAFPIDTNDREQMLKIIASCIGTKFTSRFGTLMPELALDAVS
TVAVNEPGSKREIDIKKYAKIEKLPGGSIEDCRVLSGVMFQKDVVAPGRMRRKIHNPRVL
LLDCPLEYKKGENQTNVELSREEDWAALLKLEEEYIERQCQEIVKHKPDLVVTEKGLSDL
AMHFLTKAGISAIRRLRKTDNNRIARATGATIVHRVEEIRDTDIGTRAGLFEVLKIGDEF
YSFLVDCKDPKACTILLRGASKDVLNEVERNLHDAMGVARNVLMDPRLVPGGGAVEMAIS
RGLADRAASLQGAEQGPYKAVGAALEVIPRTLAQNCGANVIRTLTKLRAKHVEKANSTFG
IDGNKGVIVDMKELGVWEPFEVKVQTIKTAVESATLLLRIDDIVSGMQKKNKMAPGQSQA
PQVEDPDAVDSEQMIQE
Download sequence
Identical sequences I0YM39
XP_005644002.1.71052 jgi|Chlvu1|76608|fgeneshCV_pg.C_scaffold_19000160 jgi|Coc_C169_1|44765|fgenesh1_pg.19_#_147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]