SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|54294|estExt_fgenesh1_pm.C_140145 from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|54294|estExt_fgenesh1_pm.C_140145
Domain Number 1 Region: 21-151,412-531
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 1.7e-79
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.00064
Further Details:      
 
Domain Number 2 Region: 218-385
Classification Level Classification E-value
Superfamily GroEL apical domain-like 8.37e-54
Family Group II chaperonin (CCT, TRIC), apical domain 0.00019
Further Details:      
 
Domain Number 3 Region: 156-221,375-412
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 1.22e-27
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|54294|estExt_fgenesh1_pm.C_140145
Sequence length 536
Sequence
MSLAFDEFGRPFIILREQDKKTRIRGIEAQKANIQAAKVISRMLQSSLGPKGMDKMLQSP
DGDVCITNDGATILEQMEVENQIGKLLVELSKSQDHEIGDGTTGVVVMAGALLEQAEMLL
DRGIHPLRIAEGYERACKVSIENLQNIAHSFNFSESDMEPLVQTCMTTLSSKIVGRVKRD
MAEMCVKAVLTVADLKRRDVNLDLIKVDGKVGGRLEDAKLVNGIVIDKDMSHPQMPKRIE
DAKIAILTCPFEPPKPKTKHKVDIDTVEKFEALRETEKQYFLDMVKQCKDSGATLVICQW
GFDDEANHLLMANDLPAVRWVGGVEIELLAMATGARIVPRFSELTPDKLGRAGVVRELSF
GTTKDRMLVIENCPNSKAVTIFVRGGNKMVLDEVKRSLHDALCVARNLVRDNSIVYGGGA
AEISCSLAVEAESEKVVGVEQFAMRAFADALDTVPLALAENAGLSPIQSLTEVKSRQYKE
KNPHLGIDCNSVGTNDMREQNVFETLIGKKQQLFLATQVCKMILKIDDVIQPANYD
Download sequence
Identical sequences I0YRD3
XP_005645496.1.71052 jgi|Coc_C169_1|54294|estExt_fgenesh1_pm.C_140145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]