SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|57655|Genemark1.6684_g from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|57655|Genemark1.6684_g
Domain Number 1 Region: 250-351
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.000000000105
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0089
Further Details:      
 
Domain Number 2 Region: 81-163
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.000000000327
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.007
Further Details:      
 
Domain Number 3 Region: 165-235
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.00000000049
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|57655|Genemark1.6684_g
Sequence length 361
Sequence
MIIETGISAFAQPAKLLVPLTAFVHSLRIISLSMQIFFNDGHLQAASHHISMSMMSRFMG
LLQRLDASLLDMAQIAVVVFTVWFLIAWKENLVDLFVRLEKKKRDLGMSTGGLERVLLPM
SSLLGWGLVTIGALMVLHVFGLNIQPLLTIGGVGGVAIGFGAQSVTSNAISGINLFLTRP
FVVGDRVELKTTGGGTVLTGFVERIDVMRTIVRTDKGVPVAVPNRSITEMIVSNESRLGR
SNVAANFKDPRQFTTSIGVRYEDLPKVKAITADIKAFLDQHPGVDKKLPYGSGLGSLQDW
SVQIGLMAHTTPSQSSNFSGFSSDVMWKLVEIVEKHGAEFAYPTQVNIHQNPQMSGAPAA
G
Download sequence
Identical sequences I0YQ39
XP_005645052.1.71052 jgi|Coc_C169_1|57655|Genemark1.6684_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]