SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|61868|Genemark1.2651_g from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|61868|Genemark1.2651_g
Domain Number 1 Region: 579-695
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.000000785
Family MgtE N-terminal domain-like 0.011
Further Details:      
 
Domain Number 2 Region: 738-831
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.000017
Family MgtE N-terminal domain-like 0.015
Further Details:      
 
Weak hits

Sequence:  jgi|Coc_C169_1|61868|Genemark1.2651_g
Domain Number - Region: 483-545
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.000863
Family MgtE N-terminal domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|61868|Genemark1.2651_g
Sequence length 978
Sequence
MAPSEEGELSAGSAEGLQASTWYTKRAQQRWVVPASGMRRLRRASSNAGSELASFEEHSA
SSGLQPAESTLKRGDLAVSHMRGEHELSPALKALSQLNHDDSGGWIHDLDRLQSKGSAVL
GGNAGIPGLKVLPSDGPSGRHEAAEVHALLRNIAAAPAFAAERALTWREEVLERLCRRAL
DQPENNRTRLVQKANGSSSLPASTEAIIGVATYRDPGNASEKSTTAASNPSRTFSDGGLN
GVGSRPGLAWDAHCMAGVLLGAGIAMADLIRQAEGACAERGAALAAAWNLHTAVCDSIME
SLREEAAQQEQKNITLQAELMHLQSAAEDNKALQREIDRLCKEVQAHEVAAARAAIKEAE
AEEKLQSGLAELDAVERMARRLLAGMRWRQATILQGSAHKQSLFRLPSARSPCPQPVLQQ
VAMLQGTSMALAVSTFRRDRTRAEQRLALQRASADSGGPGSRFANVVQDTMVGSAALLSA
MAGDAKKAAQMLDTLAPEAQAMVLATLAPSERTGLLRGMSDEGAAACLAAMSLNARGGVI
ADLTTADPTLATCALAFIWHSAALAGKWLGSMAAPEAARELLENTDLPQQRQVLLRMKAH
RAAALLEEMEAHTREGILQGLAPEATAAILQAMPRAMALSSLQALIKPIAQQVLACFGGS
ERAALLSHLSVSDTLRLIQGWVTERQREFLQALPASTATEATVQLLLQSSHKWTYSPPVP
AAVGAGYSAGEDGEDFSEQQEAEEEVDQEEVEELREAAGMELRAAAAAVFGLPFEDKAKL
IGALPPTAAAALTGTLTRQEGAQLMSELPQPQLIAILEAMGPLQRSETEDALLAISKSTG
SPRRRSLRSILRPERPDTASSIGSRASNMDSSARRTSRLSIRAGNGSASLSIEKGVGMMV
RDARVSRKSVVRPPTGGSVEEQTQGVQLRPSKVGFRKSMARPSLAGNNAQEAAQDPNQRP
SKFGPRKSMAPSTRADTP
Download sequence
Identical sequences I0Z1C4
jgi|Coc_C169_1|61868|Genemark1.2651_g XP_005648987.1.71052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]