SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Coc_C169_1|47043|estExt_fgenesh1_pg.C_60039 from Coccomyxa subellipsoidea sp. C-169 v2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Coc_C169_1|47043|estExt_fgenesh1_pg.C_60039
Domain Number 1 Region: 412-513
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000051
Family B3 DNA binding domain 0.0073
Further Details:      
 
Weak hits

Sequence:  jgi|Coc_C169_1|47043|estExt_fgenesh1_pg.C_60039
Domain Number - Region: 76-139
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0602
Family Myosin rod fragments 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Coc_C169_1|47043|estExt_fgenesh1_pg.C_60039
Sequence length 533
Sequence
MGGFRELAALTGNGLNGASTSEALLPSGQLRSFGKRKRAGAGQLQLRMPCADSLDGVRSA
YEGFDSAAARWLAAVAEREAGVTVREAACCGVQAQLAARSAELAAREGRLADWDARLRSW
DAQLQRLSSQLKDQEERVQMALQPSVCDKENSTPEDTDSDLDVTGGPRDTTEVHRGGHGW
PGALHVAGWPGALGFNQYWEANTSVAASSMLEEQQSPQQLQPIAEASPTLHIAPLSCGLR
IVKSGGDNASEDLAAAAGSPRAPAGGAAASAESPSECSAGAAAMFPDDAPHTSGVVSYQQ
QGLVDNPDPMHQFFSPSAASADGRAEQQLFQLPLFQQQQQEQYEDKQQQHQQQSFGNGVY
ERHAGSAAAAGLLLESLAQAAEEVERRAGSAAAAHRPRAPLPPPVPHQGSGFFAKTLDYK
SCDHIMCLTKDMARHLFPQPPHTSAGGPSQMSVELEDDSGRLWPMTYRCVPHRYSYELRA
GWKTFAAFWAVGVGDKVTLWREATGRLRISVHAAHSTYPAPAAGTRGRPGAAA
Download sequence
Identical sequences I0YZQ8
XP_005648421.1.71052 jgi|Chlvu1|82564|estExt_fgeneshCV_pg.C_60379 jgi|Coc_C169_1|47043|estExt_fgenesh1_pg.C_60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]