SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_000850m|PACid:19262349 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_000850m|PACid:19262349
Domain Number 1 Region: 116-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.23e-44
Family B3 DNA binding domain 0.0051
Further Details:      
 
Domain Number 2 Region: 1025-1086
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000177
Family PB1 domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_000850m|PACid:19262349
Sequence length 1134
Sequence
MKPPANGFLPSSAEGERKTINSELWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMQKE
NDFIPNYPNLPSKLICMLHNVTLHADPETDEVYAQMTLQPVNKYEKEAILASDMGLKQNR
QPTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDYSMQPPAQEIVARDLHDTTWTFRH
IYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDEKSQLLLGIRRANRQQPALSSSVIS
SDSMHIGILAAAAHAAANNSPFTIFYNPRASPSEFVIPLAKYNKAMYTQVSLGMRFRMMF
ETEESGVRRYMGTITSISDLDPLRWKNSQWRNLQVGWDESTAGERPSRVSLWETEPVVTP
FYICPPPFFRPKFPKQPGMPDDESDIENAFKRAMPWLGDDFGMKDATSSIFPGLSLVQWM
SMQQNNQFPAAQSGFFPSMVSSTGLHSNFGTDDPSKLLNFQASALAAPNLQFSKANPQNQ
VNQLPQSPIAWTQQQQLQHLLQNPLNQQQQQHPQLHQQRQQQQQLLHPQQSQQQQQQQQN
HHHHNQQPPPPPQLQPSPTPPHSQSQSQSPVPQRPQQQPQQQQQQPQQQIFLPTHVNNGV
LVPNANQNVQQPTVYSQLQQPQLLTSNTQAPQGILSNNKNSYQLTSLPQDSQFQQQMEQS
TGPLQRQQQQSQLQQSSLQFLQQSLAQRAQQQPQVQQLAQQSMSDQQLQSQLQQKLQQQQ
QQQLLSPAGSLLQPQLLQQQLAHQQNQQLSQLPPSQNHQQQLSNNLSASVLVQPQQLPMN
QPQNQNRPLTGTRAHSNHTDGDAPSCSTSPSSNNCQISPSNFLNRNQQGPAMLMGDSVVE
PSSNLVQELHSKSDARIKHELPISKGPEHLKYKGSMTDQVEASSSGTSYCLDPGNIQQNF
SLPTYCLDGDAQSHPRNSLPFVANIDGMAPDTLLSRGYDSQKDLQNLLSNYGGTPRDIET
ELSTAAISSQSFAVPNIPFKPACSNEVGINEAGVLGNGLWANQTQRMRTFTKVQKRGSVG
RSIDVTRYKGYDELRHDLARMFGIEGQLEDPQSSDWKLVYVDHENDILLVGDDPWDEFVS
CVQSIKILSSAEVQQMSLDGDLGNLPVPNQACSGSDSGNAWRHYDDNSAASFNR
Download sequence
Identical sequences V4UP50
clementine0.9_000850m|PACid:19262349 XP_006452860.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]