SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_000984m|PACid:19262959 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_000984m|PACid:19262959
Domain Number 1 Region: 121-261
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.32e-43
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 985-1063
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000523
Family PB1 domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_000984m|PACid:19262959
Sequence length 1097
Sequence
MKTPANTAGAASNSGEGGGGEKKTINTELWHACAGPLVNLPAAGTHVVYFPQGHSEQVAA
SMKKDIDGQIPNYPNLPSKLLCILLNVTLHADTETDEVYAQMTLQPVPSYDREALLRSDL
ALKSNKPQTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFSMQPPAQELMARDLHDN
IWTFRHIYRGQPKRHLLTTGWSLFVSGKRLFAGDSVLFIRDEKQQLLLGIRRANRQPANL
SSSVLSSDSMHIGILAAAAHAAANNSPFTVFYNPRASPSEFVVPLAKYYKAVHSNQISLG
MRFRMMFETEESGTRRYMGTITGISDLDPVRWKNSQWRNLQVGWDESTAGEKRNRVSIWE
IEPVTAPFFICPPPFFRSKHPRQADDDASDLDNVFKRTMPWIGDDFGVKDSQSLPGLSLV
QWMNMQQNPSLANAMQSSYMHSLPGSILQNLNGGLSQMPQQNNLQYTGQSLPQQVPQIDQ
LAKLPSTVNPLGSNILPQQPLGDISQQSRQNMITQNLPSGPVQAQVLQPQNLVQTSNILQ
QQPSIQNPQLPANLPQNLQQQQQQQHIMGQNQQQNLMQTQLPDPINQNLQMSDKQIQLHL
LQKLQQQRQSLLSQQSALQQPAQLIQLQDQQRQLLDASQSFSRSGTPTQMLEMHQVTPTS
LPQSNIMSQQIANSGSLNNVQFSQPPQQPKLEQQQPGILPQMPGHMGLPASHIINPVSTA
GNSALTGAAGVGQSVITDDNPSCSTSPSTNNCQRLIQPTINSRTHRSAGIGEEVAQSASA
LLNPSALETMPSNANLVKDLPHKSDVKPSVNISKTQNQGFFTPQTYLNGAATQTDYLDTS
SSTTSVCLSQNDVHLQQNNNSLSYNLQSTLRDTSQVGEVPVDPRSNIPYGANIDGPLGSM
NPDPLLTKGMMGLGKDFSNNISSGAMLANYENSKDAQQELSSSIVSQSFGVPDMAFNSID
STINDSSFLNGGPWAPPPQFPQRMRTYTKVYKRGAVGRSIDITRYSGYDELKQDLARRFG
IEGQLEDRGRIGWKLVYVDHENDVLLVGDDPWKEFVNCVRCIKILSPQEVQQMSLDGDFG
NSVLPHQACSSSDNGNA
Download sequence
Identical sequences V4UQ48
clementine0.9_000984m|PACid:19262959 XP_006453190.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]