SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_001089m|PACid:19273133 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_001089m|PACid:19273133
Domain Number 1 Region: 77-297,418-465
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.27e-72
Family Tandem AAA-ATPase domain 0.00000023
Further Details:      
 
Domain Number 2 Region: 467-575,671-753
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.09e-41
Family Tandem AAA-ATPase domain 0.0000379
Further Details:      
 
Domain Number 3 Region: 296-417
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 3.4e-37
Family Pre-protein crosslinking domain of SecA 0.0000923
Further Details:      
 
Domain Number 4 Region: 776-913,973-1046
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 1.13e-36
Family Helical scaffold and wing domains of SecA 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_001089m|PACid:19273133
Sequence length 1059
Sequence
MATVPTLLCANPSFFFSIKPSASRRTTLLCTKPPLSVLHFTSSPCFHQRRRFTRSTVVNA
SVKENLSRVRKTLVDFTSLNYWVVRDYYRLVEAVNAIEPQIKSLSDEQLTAKTAEFKQRL
RQGETLADIQAEAFAVVREAARRKLGMRHFDVQIIGGAVLHDGSIAEMKTGEGKTLVSTL
AAYLNALTGEGVHVVTVNDYLAQRDAEWMGRVHRFLGLSVGLIQRGMTPEERRSNYRCDI
TYTNNSELGFDYLRDNLAANSEQLVMRWPKPFHFAIVDEVDSVLIDEGRNPLLISGEASK
DVARYPVAAKVAELLVQGLHYTVELKNNSVELTEEGIALAEMALETNDLWDENDPWARFV
MNALKAKEFYRRDVQYIVRNGKALIINELTGRVEEKRRWSEGIHQAVEAKEGLKIQADSV
VVAQITYQSLFKLYPKLSGMTGTAKTEEKEFLKMFEMPVIEVPTNLPNIRVDLPIQSFAT
ARGKWEYARQEVESMFRLGRPVLVGTTSVENSEYLSDLLKQQGIPHNVLNARPKYAAREA
ETVAQAGRKYAITISTNMAGRGTDIILGGNPKMLAKKIIEDRLLPLLTREALNVEVDDKT
SSPKVLSEIKLGSSSLALLAKAALLAKYVGKAEGKSWTYQEAKSFFSESVEMSQSMNLKE
LQKLIDKQSAMYPLGPTVALTYLSVLKDCEVHCSNEGSEVKRLGGLHVIGTSLHESRRID
NQLRGRAGRQGDPGSTRFMVSLQDEMFQKFSFDTSWAVDLISRITNDEDMPIEGDAIVRQ
LLGLQISAEKYYFGIRKSLVEFDEVLEVQRKHVYDLRQSILTGANESCSQQIFQYMQAVV
DEIIFGNVDPLKHPRYWSLDKLLKEFIAIAGKILDDLFAGISGDTLLKSIEELPELNSID
INNFYFPDLPKPPNLFRGIRRKSSSLKRWLAICSDDLTKNGRYRATTNLLRKYLGDILIA
SYLNVVQESRYDDVYMKEVERAVLVKTLDCFWRDHLINMNRLSSAVNVRSFGHRNPLEEY
KIDGCRFFISMLSATRRLTVESLVQYWSSPMESQELFLS
Download sequence
Identical sequences V4SIH5
clementine0.9_001089m|PACid:19273133 XP_006434278.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]