SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_001507m|PACid:19263741 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_001507m|PACid:19263741
Domain Number 1 Region: 28-247,368-415
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.09e-73
Family Tandem AAA-ATPase domain 0.000000471
Further Details:      
 
Domain Number 2 Region: 711-933
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 1.2e-61
Family Helical scaffold and wing domains of SecA 0.0000282
Further Details:      
 
Domain Number 3 Region: 416-525,622-705
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.33e-51
Family Tandem AAA-ATPase domain 0.0000105
Further Details:      
 
Domain Number 4 Region: 246-368
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 6.93e-44
Family Pre-protein crosslinking domain of SecA 0.0000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_001507m|PACid:19263741
Sequence length 972
Sequence
MRVRASLGLGGLLGGIFKGTDTGESTRQQYAATVNTINSLEAQFSSLSDSDLRDKTSMLK
ERVQQGESLDSVLPEAFAVVREASKRVLGLRPFDVQLIGGMVLHKGEIAEMRTGEGKTLV
AILPAYLNALSGKGVHIVTVNDYLARRDCEWVGQVPRFLGLKVGLIQQSMTSEQRRENYL
CDITYVTNSELGFDYLRDNLATEIDCTFWHLQSVDELVLRNFNYCVIDEVDSILIDEART
PLIISGPAEKPSDKYYKAAKIASVFERDIHYTVDEKQKTVLLTEQGYEDAEEILDVKDLY
DPREQWASFVLNAIKAKELFLRDVNYIIRGKEVLIVDEFTGRVMQGRRWSDGLHQAVEAK
EGLPIQNETVTLASISYQNFFLQFPKLCGMTGTAATESTEFESIYKLKVTIVPTNKPMIR
KDESDVVFRSTTGKWRAVVVEISRMHKTGQPVLVGTTSVEQSDSLSEQLQEAGIPHEVLN
AKPENVEREAEIVAQSGRLGAVTIATNMAGRGTDIILGGNAEFMARLKLREMLMPRVVKP
AEGVFVSVKKPPPKKTWKVNESLFPCKLSNKNAKLAEEAVQLAVKTWGQKSLTELEAEER
LSYSCEKGPVQDEVIAKLRIAFLEIAKEYKVYTEEERKQVVSAGGLHVVGTERHESRRID
NQLRGRSGRQGDPGSSRFFLSLEDNIFRIFGGDRIQGLMRAFRVEDLPIESKMLTKALDE
AQRKVENYFFDIRKQLFEYDDVLNSQRDRVYTERRRALESDNLQSLIIEYAELTMDDILE
ANIGPDAPKESWDLEKLIAKLQQYCYLLNDLTPDLLRNKCSSYEDLQEYLRLRGREAYFQ
KMDMVEEQAPGLMKEAERFLILSNIDRLWKEHLQALKFVQQAVGLRGYAQRDPLIEYKLE
GYNLFLEMMAQIRRNVIYSIYQFKPVLVKKDQEQTLTDKSGKLVTNGRGGNKEPDPAAVE
SSSSVSSPQASA
Download sequence
Identical sequences V4TC12
clementine0.9_001507m|PACid:19263741 XP_006444618.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]