SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_001957m|PACid:19278805 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_001957m|PACid:19278805
Domain Number 1 Region: 328-430
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.88e-20
Family B3 DNA binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_001957m|PACid:19278805
Sequence length 893
Sequence
MGPRICMNPKCRTANTHEWKKGWLLRSGVCADLCYDCGSAYENFIFCNTFHLEEPGWREC
NFCSKRLHCGCRASNSFLELLDYGGVGCRSCAMSPRLHLIQRDEIPNGFGALTKKDSDDT
QTPMLENRVVGDGTAEGKLTQLCRIMEANEPSFLAPFQRGDTIVSLGQEKREELRLPFVE
VGTGFSSPTKLSSRSSKFTKPDGSRSMLDVRDMPESLAQRSSSMSLGVPAGCSNFVPPFS
NGAADGREPCKAHPSFQQGQRSRPILPKPSKTGLTISSETKKSTASQLRIARPPAEGRGK
NHLLPRYWPRITDQELQQLSGDLNSTIVPLFEKILSASDAGRIGRLVLPKACAEAYFPHI
SQSEGVPLRVQDVKGKEWVFQFRFWPNNNSRMYVLEGVTPCIQSMQLQAGDTITFSRIDP
GGKLVMGFRKAPIPGDMQDAQTSAITNGCPGESSLSGVTENLPTVSGYSGHFQMLKGSKD
PHIDALSEHLSLAEGDNGWHKSENHGQKTNEDSPQKSLLGMEKKRTRNIGSKSKRLLMHS
EEAMELRLTWEEAQDLLRPSPSARPNIVTIEDHEFEEYDEPPVFGKRTVFTARPSGEQEQ
WAPCDDCSKWRKLPTDALLPPKWTCSDNVWDSIRCSCSAAEEMIQKDLENLLRVGRESKK
RKIVESQRRDQQNEPSGLDALATAAVLGDYAGDSGEPSSVGATTTRHPRHRPGCTCIVCI
QPPSGKGKHKPTCTCNVCMTVKRRFKTLMLRKKRRQSEREVEVAQKNHSDQMGDSEMNGS
VKQESVPTSHTDNEISQTKSQTEVAESSSAQIGLDLNCYPNREDMQPEESRVSIMTLDRV
ASVPLEDCHPNGLASLSSCMLQQVNNGDHERLLSDERFLASVGWGRDQEPNLD
Download sequence
Identical sequences V4T1N2
XP_006432020.1.91645 XP_006491930.1.29302 clementine0.9_001957m|PACid:19278805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]