SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_002282m|PACid:19280048 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_002282m|PACid:19280048
Domain Number 1 Region: 147-280
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-40
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 720-798
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000108
Family PB1 domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_002282m|PACid:19280048
Sequence length 846
Sequence
MAAAASSSEVSMKSCNETGRIPMEGQNSNSTTSGVKRVGDPEMALYTELWHACAGPLVTV
PREGERVYYFPQGHIEQVEASTNQVADQQMPVYDLPSKILCRVINVQLKAEPDTDEVFAQ
VTLLPESNQDENAVEKEPPPPPPPRFHVHSFCKTLTASDTSTHGGFSVLRRHADECLPPL
DMSRQPPTQELAAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRG
ENGELRVGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAVSTGTMFTVYYKPRTSPSEF
IVPYDQYMESIKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDADPQRWRDSKWRCLKV
RWDETSTIPRPERVSPWKIEPALAPPALNSLPMPRPKRPRSNMLPSSPDSSVLTREGSSK
LNVDPSSATGFSRVLQGQEFSTLRGNFAERESNESDTAEKSVVWPPSLDDEKIDVVSASR
RYGSENWVPPGRHEPVYTDLLSGFGANADPSHGFSSPFADAVPVRKSVLDQEGKFNLVAR
PWSLMPSGPSLKMPESNAKVPVQGGDVNYQVRGNVRYGGFGDYPMLNGNRVEHSHGNWLM
PPLPPSNFENSAHSRELMPKSAMVQDQEAGKSKDCKLFGIPLFSNHVMPEPVVSHRNTMN
DPAGNLDQQFRAFESDQKSDHSKSSKLADDNQVFNEHEKLSQPSQTHTKDVRSKTQCGST
RSCTKVQKQGIALGRSVDLSKFNNYDELIAELDQLFEFDGELMAPKKNWIIVYTDDEGDM
MLVGDDPWQEFCGMVRKIFIYTKEEVLKMNSVSFSSKGEDSPMNGDGIDAKEVKQPLPLA
SNAENF
Download sequence
Identical sequences V4TF44
XP_006436945.1.91645 clementine0.9_002282m|PACid:19280048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]