SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_002323m|PACid:19266460 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_002323m|PACid:19266460
Domain Number 1 Region: 558-833
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.93e-82
Family Protein kinases, catalytic subunit 0.0000121
Further Details:      
 
Domain Number 2 Region: 121-260
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.93e-40
Family B3 DNA binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_002323m|PACid:19266460
Sequence length 843
Sequence
MSFAAAAVPLNHASGGPPTGGSNDALYRELWHACAGPLATLPCEGQRVYYFPQGHMEQLE
ASMHQELEQQMPSFNLPSKILCKVVNVQRRAEPETDEVYAQITLLPEPDQSEVTSPDPPI
PEPEKCTVHSFCKTLTASDTSTHGGFSVLHRHADDCLPPLDMSRQPPWQELVATDLHGNE
WNFRHIFRDQPRRHLLTIGWSVFVSSKKLVAGDAFIFLRGENEELRVGVRRHMRQQTNMP
SSVISSHSMHLGVLAIASHAIATGTLFSIFYKPRTSRSEFIVSVNKYLEAKKHKLSVGMG
FKMTFEGEEVPEQRFSGTIVGVGDCKSSVWPDSEWRSLKVQWDEPSSILRPDRVSSWELE
PLVATTTTTNAQPAQRNKRSRPPVLPSPAAWDEPSSILRPDRVSSWELEPLVATTTTTNA
QTAQRNKRSRPPVSPSPAADISVLENLTESFAPVVNKESSEKRQGNGNTCRQFGIPHIDN
SNVEEASPAFTMSGAMGDDRAIPCLDADSDQHSEPSNINRSDVPSVSCDAEKSCPRSPQE
SQSRQIRSCTKASSLSMEPVYNVSSNGKFRRRIMSWQKGELLGSGSFGSVYEGLTDDGFF
FAVKEVSLQDQGAQGKQSILQLEQEISLLSQFEQDNIVQYLGTDKDENRLYIFLELVTKG
SLANLYQKYHLSDSQVSSYTRQILNGLVYLHERNVVHRDIKCANILVDASGSVKLADFGL
AKATTMNDLKSCKGTPFWMAPEVVNSKNDGYGLTADIWSLGCTVLEMLTRRPPYSHLEGV
QALFRIGKGELPSVPSSLSRDARDFILKCLQVNPNDRPTVTELMEHPFVKRPLQTPRCGQ
ANC
Download sequence
Identical sequences clementine0.9_002323m|PACid:19266460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]