SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_003537m|PACid:19282578 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_003537m|PACid:19282578
Domain Number 1 Region: 107-216
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.15e-28
Family B3 DNA binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_003537m|PACid:19282578
Sequence length 724
Sequence
MKEVEKSIDPQLWHACAGSMVQIPPLNSTVFYFPQGHAEHSLGSVNFPSSSRIPPLIFCR
VSSLKFLADSETDEVYAKIKLVPIPANEIDFEDNNLSLNSVGSDSESEKPASFAKTLTQS
DANNGGGFSVPRYCAETIFPRLDYTADPPVQTVVAKDVHGEIWKFRHIYRGTPRRHLLTT
GWSTFVNQKKLVAGDSIVFLRAQDGDLCVGIRRAKKGIGGGNESPSSGWNSNNGSCVTGN
PFGGFSCFLREEENKMARNGNMNLNSYGSFNSSGNMRGNGGRVKPEMVLEAVALAASGKP
FEVVYYPRASTPEFCVKASAVKAAMRVHWLCGMRFKMAFETEDSSRISWFMGTISSVQVA
DPISWPNSPWRLLQVTWDEPDLLQNVKRVSPWLVELVSNMPVIHLSPFSPARKKLRLPQQ
LDFPFDGQFTMPLFSGNPLGPSSPLCCLSDNTSAGIQGARHAQFGISSSDFHVNNKLQSG
LFLSSLQRFTPNSRDSDGILTSHTNSSENLSCLLTMGNSNQNLEKSENIKKHQFLLFGQP
ILTEQQISHSCSDDVVSQVLGKSSSDGHSDKVKASSDGSGSIHEQRISIEKSSSSEFFWN
RSFQVTESGLDTGHCKVFLESEDVGRTLDLSVLSSYEELYRRLAIMFGIERSDMLSHVLY
QDASGAIKRTGDEPFSDFMKSAKRLTILMGSGSDSVGRTWITGMRTPKNGLDASNKTGPL
SIFA
Download sequence
Identical sequences V4SBC2
XP_006424557.1.91645 clementine0.9_003537m|PACid:19282578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]