SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_004085m|PACid:19265463 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_004085m|PACid:19265463
Domain Number 1 Region: 121-260
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.79e-44
Family B3 DNA binding domain 0.0032
Further Details:      
 
Domain Number 2 Region: 560-635
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000615
Family PB1 domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_004085m|PACid:19265463
Sequence length 682
Sequence
MAFAAAAAPLNHASGGPRTGGSNDALYRELWHACAGPLVTLPREGERVYYFPQGHMEQLE
ASMHQGLEQQMPSFNLPSKILCKVVNVQRRAEPETDEVYAQITLLPEPDQSEVTSPDPPI
PEPEKCTVHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQQPPWQELVATDLHGNE
WHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFLRGENEELRVGVRRHMRQQTNMP
SSVISSHSMHLGVLATASHAIATGTLFSIFYKPRTSRSEFIVSVNKYLEAKRHKLSVGMR
FKMTFEGEEVPERRFSGTIVGVGDCRSSVWQDSEWRSLKVQWDEPSSILRPERVSSWELE
PLVATTTTTNAQPAQRNKRSRPPVLPSPAADISVLGMWKSHVESSAFSYCDSPQGRDLYP
SPKFSTATKGNHFGLSGNKSLAAVSSNSMYWPNRAENVTESFAPVVNKECSEKRQGNGNT
CRLFGIQLVDNSNVEEASPAFTMSGAMGDDRAIPCLDADSDQHSEPSNINRSDVPSVSCD
AEKSCLRSPQESQSRQIRSCTKVHMQGIAVGRAVDLTRFDCYEDLLKKLEEMFDIEGDLC
GSTKKWQVVYTDDEDDMMMVGDDPWHEFCSMVRKIFIYTAEEVKKLSPKVKLPGNEELNA
GKPDVEVVVNTDDRSSIVGPGC
Download sequence
Identical sequences V4SAY2
XP_006431443.1.91645 clementine0.9_004085m|PACid:19265463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]