SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_005990m|PACid:19253285 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_005990m|PACid:19253285
Domain Number 1 Region: 115-232
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.05e-29
Family B3 DNA binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_005990m|PACid:19253285
Sequence length 578
Sequence
MPSQQPYSPAEPRAVDPRIWRACAGSSVQIPSVNSRVYYFPQGHVEQSCPSITLSVTKPF
IPCLITHVEFLADPVTDQVFAKVVLNPITALEPSRNFLEQQQEQQPRGLSIGNVEENNVV
AFAKILTPSDANNGGGFSVPRFCADSIFPPLNYQVDPPVQNISVTDIHGAVWEFRHIYRG
TPRRHLLTTGWSKFVNRKKLIAGDSVVFMRDSRGKMYIGLRRSVRYGNNGDSAGARWREQ
TGMKAEAVAVAVERAVLGLPFEVVYYPRAGWADFIVRAEVVDSAMRVFWTAGMRVKMVVE
TEDSSRMTWIQGTVTAASMPDRGPWCGSPWGMLEVTWDEPEILQNAKRVSPWQIEFVSPT
QPLHTAFPPAKRLKFSPNYGSMTDVEEEIFFPVNGLGNSTVGCLNPSLLNYNTFPAGMQG
ARQNPYSLFSLSNFISENNHQMSSDGIFGNNMVPKLRRVSTELNIGSSQSDNLSPDSHSS
VHSFGTELGGNQGCNSTKVGVRSIQLFGKIIHMKQPVESGFGDVVCPHDDGSKGFSERED
VNLPLDLSLTYTELLNRFGIQGRGSEVEDEVVAEACSL
Download sequence
Identical sequences V4TCG2
clementine0.9_005981m|PACid:19253286 clementine0.9_005984m|PACid:19253284 clementine0.9_005990m|PACid:19253285 XP_006434090.1.91645 XP_006434091.1.91645 XP_006434092.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]