SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_007611m|PACid:19274451 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_007611m|PACid:19274451
Domain Number 1 Region: 390-491
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.34e-23
Family B3 DNA binding domain 0.0082
Further Details:      
 
Domain Number 2 Region: 172-270
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.42e-23
Family B3 DNA binding domain 0.0073
Further Details:      
 
Domain Number 3 Region: 6-71
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000706
Family B3 DNA binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_007611m|PACid:19274451
Sequence length 517
Sequence
MEGRTSGSVTLIGPSWDTWHIDLIQQDDNLFFDKGWPVFLRDNFIECGDLLVFRYDGELH
FTVQIFDQSGCEKEAAFNSKSTSTGQKREREEAVAHSDKALQSLLKKIRECSSSFESDCI
DDNRDREADSCEETRRCLSLSTIFASPSQPKTCNIKPEDEEKKVAQSFISAFPYFVRKMK
RFNVSGSYTLNIPYQFSMAHLPNFKTEVVLHNLKGASWTVNSVPTTKVHTSHTFCGGWLA
FVRGNEIKLGDICIFELVHKCELHVYILRVGKQYPDSQRGTTVLTGSNVSSTTISCKQFD
GVPKKVKKNSLKKIQLCNVKGSKSCEIKKHIGTDGNSVSIATCCLPKISHEKSEAAAQNR
NNVEAKMDSTPGGNLRTMMALDEEKAARSFNSCVPHFVRIMRKFNISGSYTLKIPYKFAM
AHLPDCKTEIVLRNLKGECWTVNSLPDSKGRMVHTFCGGWMAFVRGNDIKIGDVCIFELI
SKLDMRVHITGVGRKEVDLESGKLTSNESSTVDHPLF
Download sequence
Identical sequences V4TEN9
clementine0.9_007602m|PACid:19274452 clementine0.9_007611m|PACid:19274451 clementine0.9_007612m|PACid:19274449 clementine0.9_007619m|PACid:19274450 XP_006434878.1.91645 XP_006434879.1.91645 XP_006434880.1.91645 XP_006434881.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]