SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_007642m|PACid:19284498 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_007642m|PACid:19284498
Domain Number 1 Region: 137-235
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-22
Family B3 DNA binding domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_007642m|PACid:19284498
Sequence length 516
Sequence
MDLELEVKKEVVDEHVNTTSHRSEAARPTDDEEATIAQLSLLPASSKPKRKRKPKTIFSA
DEPMKPSKKKGKIILKLKKSPPDTSVTSVPGTVEPDSRGGGKTKSSKKNKDVVDGKCSPV
EPKSPAMIRAEEVQSNLEPQFPSFAKSMVRSHVASCFWMGLPGYFCKSHLPDKDTSVVLE
DESGIQYTAKYFAEKTGLSAGWRQFSTAHNLVEGDVLVFQLIAPLKLKVYIIRANDFTEV
DGALGLLNLDAPSKQNDTAELEIDNGEPIVVTNQNTKKKRKKSLPLAVVQKKNKKSVQGR
SASNLGQPAEQSENDSEEVGSEVLEGFKISTPPVQFKDVTSLDNFNILVDGLVVDSELPE
DIRCNYYKLCCSQNAFLHENLAQGINFKLIVGTISEIVNIADALRACKFTTSRDEFAMWD
KTLKAFELLGMSVGFLRARLRRLQRLAFESEGAEDTRRYIEAKAQQSQTQDEIRNIEARL
VELKGAWQRFDAEISSLKSSAESYELKFREVANAPW
Download sequence
Identical sequences V4SJT6
XP_006425870.1.91645 XP_006466621.1.29302 clementine0.9_007642m|PACid:19284498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]