SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_009752m|PACid:19271820 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_009752m|PACid:19271820
Domain Number 1 Region: 89-186
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.67e-22
Family B3 DNA binding domain 0.0046
Further Details:      
 
Weak hits

Sequence:  clementine0.9_009752m|PACid:19271820
Domain Number - Region: 391-448
Classification Level Classification E-value
Superfamily Tropomyosin 0.0265
Family Tropomyosin 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_009752m|PACid:19271820
Sequence length 458
Sequence
MEEQSEPETPLLQTTKIKRKKTAESKMKLTQVSEKPLDPDSAPELGAFDSSKESKSRRKR
AMIDDLYDHAKVNSPVIERAEEVRANLAPSYPSFWKAMVKSNVSHGFWLHLPMRFCKFNM
PKIDTVFIVENESGEEYKINYISQRTALSGGWKAFSDANQLYEGDVLVFHLVEPTRFKAY
IVRANGFGNVNADAKPLNSVPMDDELEVAPKDHSEKRVKKNKRAKRVKPPPGFHRDNNQS
NSLMLLETNNGHVEDQFNNDTEDLGPNKVLPHSESSNFKEMKSIDDFTILVDGLAIDCEL
SDQHRNKYYDLCCSQNSFLHDHLLKSINCKLAAEIITQTVNIAEAIRACNLSTSRADYEI
WDKTLKGFELLGMNVGFLRARLNRLMSLAFESEESEVSKRLREVSAEQARAEEEMRSLEL
KLLRLKETMGRLDSEVESLKVKAEKHELKFQEEANAPW
Download sequence
Identical sequences V4UAJ3
clementine0.9_009752m|PACid:19271820 XP_006423044.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]