SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_011716m|PACid:19258884 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_011716m|PACid:19258884
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 7.33e-28
Family N-terminal domain of MutM-like DNA repair proteins 0.0011
Further Details:      
 
Domain Number 2 Region: 147-240
Classification Level Classification E-value
Superfamily S13-like H2TH domain 5.36e-24
Family Middle domain of MutM-like DNA repair proteins 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_011716m|PACid:19258884
Sequence length 408
Sequence
MPELPEVEAARRAIEEHCIGKKIVKSIIADDSKVIDGVSASDFEASVLGKAILSAHRKGK
NLWLRLDSPPFPSFQFGMTGAIYIKGVAVTQYKRSAVKDTDEWPSKYSKFFVELDDGLEL
SFTDKRRFAKVRLLNDPTSVPPISELGPDALLEPMTVDEFTDSLSKKKITLKALLLDQSY
ISGIGNWVADEVLYQAKIHPLQTAVSLSKESCATLLKCIKEVIEKALEVGADSSQFPSNW
IFHSREKKPGKAFVDGKKIDFITAGGRTTAYVPELQKLNGVQAAKAVGKPRKQAPKGEDS
KDDDKYNSGDESESDGEEIAENVKSKKRQKLGGQVKQPSPRKRKSKESDTEDDDGGNDDD
GGGSDDNAEEAPKTKSGKVTKNKQAKAVTTSKEKVISQKGKPSKKKAK
Download sequence
Identical sequences V4SP53
clementine0.9_011716m|PACid:19258884 XP_006427395.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]