SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_013531m|PACid:19267713 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_013531m|PACid:19267713
Domain Number 1 Region: 120-232
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-31
Family B3 DNA binding domain 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_013531m|PACid:19267713
Sequence length 368
Sequence
MSINHFSTDLQETPWWQQHPQQLQQSMMETTQNSSNNSSSSATDPQQQQFSSWSSPHHHH
QFYHHHQQHQHHLWLDSYNNNNNNSHHNPTLSFNLNSQHDATEAHPMTNLNSNQEQELEK
EPMFEKPLTPSDVGKLNRLVIPKQHAEKYFPLGGGGADLGSSSSDKGLLLSFEDESGKCW
RFRYSYWNSSQSYVLTKGWSRYVKEKRLDAGDVILFERHRTDSERLFIGWRRRGATAVAQ
VAQAGGAAAGGCGWPRGLYPNHPYPVDVAHGHGVSAPLYQHAGSGVQSQTTSVGNSRTLR
LFGVNFECQVDDKSEGSESQAEAHGHQQFNYPVEAYDSNSTNRHNHVVGQFNCLCYRHSV
IANKIMSN
Download sequence
Identical sequences V4SWF2
clementine0.9_013531m|PACid:19267713 XP_006430125.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]