SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for clementine0.9_014128m|PACid:19269841 from Citrus clementina v165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  clementine0.9_014128m|PACid:19269841
Domain Number 1 Region: 50-280
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.65e-51
Family PP-loop ATPase 0.047
Further Details:      
 
Weak hits

Sequence:  clementine0.9_014128m|PACid:19269841
Domain Number - Region: 289-309
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0405
Family Recombination protein RecR 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) clementine0.9_014128m|PACid:19269841
Sequence length 356
Sequence
MEVAESKSKKAGGRLCSTCNQRKAALKRPKTLEQICRECFYEVFEEEIHQVIVGNQLFKA
GERIAIGASGGKDSTVLAFVLSELNRRHNYGLDLFLLSIDEGISGYRDDSLQTVKRNEIQ
YGLPLKIVSYKDLYGWTMDEIVKVIGLKNNCTFCGVFRRQALDRGASLLKVDKIATGHNA
DDIAETVLLNILRGDIARLSRCTLITTGEDGPIPRCKPFKYTYEKEIVMYAYFKRLDYFS
TECIYSPNAYRGFAREFIKDLERLRPRAILDIIKSGENFRISTSTKMPEQGTCERCGYIS
SQKWCKACVLLEGLNRGLPKMGIVRSRGQNNERTKDMKQNKGTKNIESKQCGTLDF
Download sequence
Identical sequences V4TFP4
clementine0.9_014128m|PACid:19269841 XP_006435296.1.91645 XP_006473748.1.29302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]